Lineage for d3etrb1 (3etr B:224-414)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437012Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1437013Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1437083Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1437142Protein automated matches [232070] (1 species)
    not a true protein
  7. 1437143Species Bos taurus [TaxId:9913] [232074] (3 PDB entries)
  8. 1437145Domain d3etrb1: 3etr B:224-414 [232084]
    Other proteins in same PDB: d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm2
    automated match to d3b9jb2
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etrb1

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etrb1 d.145.1.3 (B:224-414) automated matches {Bos taurus [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3etrb1:

Click to download the PDB-style file with coordinates for d3etrb1.
(The format of our PDB-style files is described here.)

Timeline for d3etrb1: