Lineage for d3eub21 (3eub 2:2-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179355Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2179518Protein automated matches [231466] (4 species)
    not a true protein
  7. 2179519Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)
  8. 2179538Domain d3eub21: 3eub 2:2-92 [232078]
    Other proteins in same PDB: d3eub22, d3eub31, d3eub32, d3eub41, d3eub42, d3euba2, d3eubb1, d3eubb2, d3eubc1, d3eubc2, d3eubj2, d3eubk1, d3eubk2, d3eubl1, d3eubl2, d3eubs2, d3eubt1, d3eubt2, d3eubu1, d3eubu2
    automated match to d1fiqa2
    complexed with fad, fes, mom, mte, xan

Details for d3eub21

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (2:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eub21 d.15.4.2 (2:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3eub21:

Click to download the PDB-style file with coordinates for d3eub21.
(The format of our PDB-style files is described here.)

Timeline for d3eub21: