Lineage for d3etrm1 (3etr M:224-414)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675867Protein automated matches [232070] (1 species)
    not a true protein
  7. 1675868Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)
  8. 1675882Domain d3etrm1: 3etr M:224-414 [232076]
    Other proteins in same PDB: d3etra1, d3etra2, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm2, d3etrn1, d3etrn2
    automated match to d3b9jb2
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etrm1

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (M:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etrm1 d.145.1.3 (M:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3etrm1:

Click to download the PDB-style file with coordinates for d3etrm1.
(The format of our PDB-style files is described here.)

Timeline for d3etrm1: