Lineage for d3et0a1 (3et0 A:207-477)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2009039Domain d3et0a1: 3et0 A:207-477 [232068]
    Other proteins in same PDB: d3et0a2, d3et0b2
    automated match to d3et3a_
    complexed with et0, glc

Details for d3et0a1

PDB Entry: 3et0 (more details), 2.4 Å

PDB Description: Structure of PPARgamma with 3-(5-Methoxy-1H-indol-3-yl)-propionic acid
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3et0a1:

Sequence, based on SEQRES records: (download)

>d3et0a1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d3et0a1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikeva
irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
tetdmslhpllqeiykdly

SCOPe Domain Coordinates for d3et0a1:

Click to download the PDB-style file with coordinates for d3et0a1.
(The format of our PDB-style files is described here.)

Timeline for d3et0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3et0a2