SCOPe 2.03: Domain d3eqva1: 3eqv A:53-237

Lineage for d3eqva1 (3eqv A:53-237)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (4 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [225540] (2 PDB entries)

8. Domain d3eqva1: 3eqv A:53-237 [232067]
   Other proteins in same PDB: d3eqva2, d3eqvb2
   automated match to d3equa1
   complexed with gol, so4; mutant

Details for d3eqva1

PDB Entry: 3eqv, 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing four mutations associated with penicillin resistance

PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d3eqva1:

Sequence, based on SEQRES records:

>d3eqva1 d.175.1.0 (A:53-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tynflkeqgdnrivrtqalpatrgtvsdrngavlalsapteslfavpkdmkempsaaqle
rlselvdvpvdvlrnkleqkgksfiwikrqldpkvaeevkalglenfvfekelkrhypmg
nlfahvigftdidgkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqng
kdiil

Sequence, based on observed residues (ATOM records):

>d3eqva1 d.175.1.0 (A:53-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tynflkeqgdnrivrtqalpatrgtvsdrngavlalsapteelkrhypmgnlfahvigft
didgkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqngkdiil

Timeline for d3eqva1:

• d3eqva1 is new in SCOPe 2.03-stable
  
• d3eqva1 appears in SCOPe 2.04
  
• d3eqva1 appears in the current release, SCOPe 2.08