Lineage for d3ep1b_ (3ep1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973041Species Alvinella pompejana [TaxId:6376] [232063] (1 PDB entry)
  8. 2973043Domain d3ep1b_: 3ep1 B: [232065]
    automated match to d2rkqa_

Details for d3ep1b_

PDB Entry: 3ep1 (more details), 2.1 Å

PDB Description: Structure of the PGRP-Hd from Alvinella pompejana
PDB Compounds: (B:) PGRP-Hd - Peptidoglycan recognition protein homologue

SCOPe Domain Sequences for d3ep1b_:

Sequence, based on SEQRES records: (download)

>d3ep1b_ d.118.1.0 (B:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmgltadkcqgclqdsscte
qivkalqdadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfg
kkepsqalqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

Sequence, based on observed residues (ATOM records): (download)

>d3ep1b_ d.118.1.0 (B:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcsgclqdsscteqivkalqdad
fkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfgkkepsqalqd
alskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

SCOPe Domain Coordinates for d3ep1b_:

Click to download the PDB-style file with coordinates for d3ep1b_.
(The format of our PDB-style files is described here.)

Timeline for d3ep1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ep1a_