SCOPe 2.08: Domain d3ep1b_: 3ep1 B:

Lineage for d3ep1b_ (3ep1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (10 species)
   not a true protein

7. Species Alvinella pompejana [TaxId:6376] [232063] (1 PDB entry)

8. Domain d3ep1b_: 3ep1 B: [232065]
   automated match to d2rkqa_

Details for d3ep1b_

PDB Entry: 3ep1, 2.1 Å

PDB Description: Structure of the PGRP-Hd from Alvinella pompejana

PDB Compounds: (B:) PGRP-Hd - Peptidoglycan recognition protein homologue

SCOPe Domain Sequences for d3ep1b_:

Sequence, based on SEQRES records:

>d3ep1b_ d.118.1.0 (B:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmgltadkcqgclqdsscte
qivkalqdadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfg
kkepsqalqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

Sequence, based on observed residues (ATOM records):

>d3ep1b_ d.118.1.0 (B:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcsgclqdsscteqivkalqdad
fkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfgkkepsqalqd
alskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

Timeline for d3ep1b_:

• d3ep1b_ first appeared in SCOPe 2.03
  
• d3ep1b_ appears in SCOPe 2.07