SCOPe 2.07: Domain d3ep1a_: 3ep1 A:

Lineage for d3ep1a_ (3ep1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (9 species)
   not a true protein

7. Species Alvinella pompejana [TaxId:6376] [232063] (1 PDB entry)

8. Domain d3ep1a_: 3ep1 A: [232064]
   automated match to d2rkqa_

Details for d3ep1a_

PDB Entry: 3ep1, 2.1 Å

PDB Description: Structure of the PGRP-Hd from Alvinella pompejana

PDB Compounds: (A:) PGRP-Hd - Peptidoglycan recognition protein homologue

SCOPe Domain Sequences for d3ep1a_:

Sequence, based on SEQRES records:

>d3ep1a_ d.118.1.0 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmgltadkcqgclqdsscte
qivkalqdadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfg
kkepsqalqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

Sequence, based on observed residues (ATOM records):

>d3ep1a_ d.118.1.0 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmggclqdsscteqivkalq
dadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfgkkepsqa
lqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl

Timeline for d3ep1a_:

• d3ep1a_ first appeared in SCOPe 2.03
  
• d3ep1a_ appears in SCOPe 2.06
  
• d3ep1a_ appears in the current release, SCOPe 2.08