Lineage for d3eika1 (3eik A:20-113)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1668834Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1669013Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 1669014Protein automated matches [227057] (3 species)
    not a true protein
  7. 1669015Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)
  8. 1669020Domain d3eika1: 3eik A:20-113 [232061]
    automated match to d1ytba1
    complexed with edo

Details for d3eika1

PDB Entry: 3eik (more details), 1.9 Å

PDB Description: double stranded DNA binding protein
PDB Compounds: (A:) tata-box-binding protein

SCOPe Domain Sequences for d3eika1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eika1 d.129.1.0 (A:20-113) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
giiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgkm
vitgaksekssrmaaqryakiihklgfnatfddf

SCOPe Domain Coordinates for d3eika1:

Click to download the PDB-style file with coordinates for d3eika1.
(The format of our PDB-style files is described here.)

Timeline for d3eika1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eika2