![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein automated matches [190411] (4 species) not a true protein |
![]() | Species Emericella nidulans [TaxId:162425] [232056] (1 PDB entry) |
![]() | Domain d3eh8g1: 3eh8 G:3-125 [232059] Other proteins in same PDB: d3eh8a3, d3eh8d3, d3eh8g3 automated match to d1p8kz1 protein/DNA complex; protein/RNA complex; complexed with ca |
PDB Entry: 3eh8 (more details), 2.7 Å
SCOPe Domain Sequences for d3eh8g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eh8g1 d.95.2.1 (G:3-125) automated matches {Emericella nidulans [TaxId: 162425]} dltyaylvglyegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrkrn eiemvalrirdknhlkskilpifekypmfsnkqydylrfrnallsgiiyledlpdytrsd epl
Timeline for d3eh8g1: