Lineage for d3efzd_ (3efz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007221Protein 14-3-3 protein cgd1_2980 [158770] (1 species)
  7. 2007222Species Cryptosporidium parvum [TaxId:5807] [158771] (2 PDB entries)
    Uniprot Q5CSF3 25-247
  8. 2007226Domain d3efzd_: 3efz D: [232053]
    automated match to d3efzc_
    complexed with edo

Details for d3efzd_

PDB Entry: 3efz (more details), 2.08 Å

PDB Description: Crystal Structure of a 14-3-3 protein from cryptosporidium parvum (cgd1_2980)
PDB Compounds: (D:) 14-3-3 protein

SCOPe Domain Sequences for d3efzd_:

Sequence, based on SEQRES records: (download)

>d3efzd_ a.118.7.1 (D:) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]}
ayrakladmvgnykdvikvltessdfrdnslilllagslrnrvtsirnslksiksqeekl
rkekslnnefiqviedikrdfeesillesedviriiddnllmyseegarafciklkgdlm
rykaeilkdeeknqcikqavefyedalqrersflekypsdplylatilnytilkydllgn
pegamkfanraiqaaensrsdseqfsentekllkilrdnvsq

Sequence, based on observed residues (ATOM records): (download)

>d3efzd_ a.118.7.1 (D:) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]}
ayrakladmvgnykdvikvltessdslilllagslrnrvtsirnslksiksqeeklrkek
slnnefiqviedikrdfeesillesedviriiddnllmyseegarafciklkgdlmryka
eilkdeeknqcikqavefyedalqrersflekypsdplylatilnytilkydllgnpega
mkfanraiqaaenseqfsentekllkilrdnvsq

SCOPe Domain Coordinates for d3efzd_:

Click to download the PDB-style file with coordinates for d3efzd_.
(The format of our PDB-style files is described here.)

Timeline for d3efzd_: