Lineage for d3e6mb_ (3e6m B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695024Species Silicibacter pomeroyi [TaxId:246200] [225430] (2 PDB entries)
  8. 2695026Domain d3e6mb_: 3e6m B: [232050]
    automated match to d3cjna_

Details for d3e6mb_

PDB Entry: 3e6m (more details), 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.
PDB Compounds: (B:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6mb_:

Sequence, based on SEQRES records: (download)

>d3e6mb_ a.4.5.0 (B:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
latlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplindfh
aelvgnvdpdklqtcievlgeilkgktdy

Sequence, based on observed residues (ATOM records): (download)

>d3e6mb_ a.4.5.0 (B:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
latlgvmeqsttsrtvdqlvdeglaarsisdqrkrtvvltrkgkkklaeisplindfhae
lvgnvdpdklqtcievlgeilkgktdy

SCOPe Domain Coordinates for d3e6mb_:

Click to download the PDB-style file with coordinates for d3e6mb_.
(The format of our PDB-style files is described here.)

Timeline for d3e6mb_: