Lineage for d3e6ma_ (3e6m A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723162Species Silicibacter pomeroyi [TaxId:89184] [232048] (1 PDB entry)
  8. 1723163Domain d3e6ma_: 3e6m A: [232049]
    automated match to d3cjna_

Details for d3e6ma_

PDB Entry: 3e6m (more details), 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.
PDB Compounds: (A:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6ma_:

Sequence, based on SEQRES records: (download)

>d3e6ma_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplind
fhaelvgnvdpdklqtcievlgeilkgkt

Sequence, based on observed residues (ATOM records): (download)

>d3e6ma_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsidqrkrtvvltrkgkkklaeisplindfha
elvgnvdpdklqtcievlgeilkgkt

SCOPe Domain Coordinates for d3e6ma_:

Click to download the PDB-style file with coordinates for d3e6ma_.
(The format of our PDB-style files is described here.)

Timeline for d3e6ma_: