![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
![]() | Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) ![]() contains heme-dependent enzymes |
![]() | Family a.266.1.0: automated matches [227197] (1 protein) not a true family |
![]() | Protein automated matches [226924] (2 species) not a true protein |
![]() | Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries) |
![]() | Domain d3e08a_: 3e08 A: [232046] automated match to d2noxb_ complexed with hem, trp; mutant |
PDB Entry: 3e08 (more details), 1.9 Å
SCOPe Domain Sequences for d3e08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e08a_ a.266.1.0 (A:) automated matches {Xanthomonas campestris [TaxId: 340]} lrdlepgihtdlegrltyggylrldqllsaqqplsepahhdemlfiiqsqtselwlklla helraaivhlqrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgf qslqyryiefllgnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqq yqardwtaahvaddtlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmr vigfkrgtggssgvgflqqalaltffpelfdvrtsvgvdn
Timeline for d3e08a_: