SCOPe 2.08: Domain d3e01a2: 3e01 A:430-556

Lineage for d3e01a2 (3e01 A:430-556)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)

8. Domain d3e01a2: 3e01 A:430-556 [232044]
   Other proteins in same PDB: d3e01a1, d3e01b_
   automated match to d3di6a3
   complexed with pz2

Details for d3e01a2

PDB Entry: 3e01, 2.95 Å

PDB Description: HIV-RT with non-nucleoside inhibitor annulated pyrazole 2

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3e01a2:

Sequence; same for both SEQRES and ATOM records:

>d3e01a2 c.55.3.0 (A:430-556) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d3e01a2:

• d3e01a2 first appeared in SCOPe 2.03
  
• d3e01a2 appears in SCOPe 2.07