SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dyaa2 (3dya A:430-555)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125039Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)
  8. 2125040Domain d3dyaa2: 3dya A:430-555 [232042]
    Other proteins in same PDB: d3dyaa1, d3dyab_
    automated match to d3di6a3
    complexed with pzl

Details for d3dyaa2

PDB Entry: 3dya (more details), 2.3 Å

PDB Description: HIV-1 RT with non-nucleoside inhibitor annulated Pyrazole 1
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3dyaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyaa2 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag

SCOPe Domain Coordinates for d3dyaa2:

Click to download the PDB-style file with coordinates for d3dyaa2.
(The format of our PDB-style files is described here.)

Timeline for d3dyaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dyaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3dyab_