Lineage for d3dv9a1 (3dv9 A:1-243)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149398Species Bacteroides vulgatus [TaxId:435590] [232039] (1 PDB entry)
  8. 2149399Domain d3dv9a1: 3dv9 A:1-243 [232040]
    Other proteins in same PDB: d3dv9a2
    automated match to d3qxga_
    complexed with edo, mg, po4

Details for d3dv9a1

PDB Entry: 3dv9 (more details), 1.72 Å

PDB Description: Putative beta-phosphoglucomutase from Bacteroides vulgatus.
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d3dv9a1:

Sequence, based on SEQRES records: (download)

>d3dv9a1 c.108.1.0 (A:1-243) automated matches {Bacteroides vulgatus [TaxId: 435590]}
mfkeainnylhthgyesidlkavlfdmdgvlfdsmpnhaeswhkimkrfgfglsreeaym
hegrtgastinivsrrerghdateeeikaiyqakteefnkcpkaermpgalevltkikse
gltpmvvtgsgqtslldrlnhnfpgifqanlmvtafdvkygkpnpepylmalkkggfkpn
ealvienaplgvqagvaagiftiavntgplhdnvllneganllfhsmpdfnknwetlqsa
lkq

Sequence, based on observed residues (ATOM records): (download)

>d3dv9a1 c.108.1.0 (A:1-243) automated matches {Bacteroides vulgatus [TaxId: 435590]}
mfkeainnylhthgyesidlkavlfdmdgvlfdsmpnhaeswhkimkrfgfglsreeaym
hegrtgastinivsrrerghdateeeikaiyqakteefnkcpkaermpgalevltkikse
gltpmvvtgsglldrlnhnfpgifqanlmvtafdvkygkpnpepylmalkkggfkpneal
vienaplgvqagvaagiftiavntgplhdnvllneganllfhsmpdfnknwetlqsalkq

SCOPe Domain Coordinates for d3dv9a1:

Click to download the PDB-style file with coordinates for d3dv9a1.
(The format of our PDB-style files is described here.)

Timeline for d3dv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dv9a2