Lineage for d3dbxa2 (3dbx A:188-285)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764875Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries)
  8. 1764894Domain d3dbxa2: 3dbx A:188-285 [232033]
    Other proteins in same PDB: d3dbxa1, d3dbxb_
    automated match to d3jvga2
    complexed with nag, plm

Details for d3dbxa2

PDB Entry: 3dbx (more details), 2 Å

PDB Description: Structure of chicken CD1-2 with bound fatty acid
PDB Compounds: (A:) CD1-2 antigen

SCOPe Domain Sequences for d3dbxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbxa2 b.1.1.0 (A:188-285) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rvppmavvfartagqvqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl
tyqlrstllvspqdghgyacrvqhcslgdrsllvpwhh

SCOPe Domain Coordinates for d3dbxa2:

Click to download the PDB-style file with coordinates for d3dbxa2.
(The format of our PDB-style files is described here.)

Timeline for d3dbxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dbxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3dbxb_