Lineage for d3dl5b2 (3dl5 B:181-521)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536167Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2536168Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2536169Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2536512Protein automated matches [190469] (15 species)
    not a true protein
  7. 2536520Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)
  8. 2536521Domain d3dl5b2: 3dl5 B:181-521 [232027]
    Other proteins in same PDB: d3dl5a1, d3dl5b1, d3dl5c1, d3dl5d1, d3dl5e1
    automated match to d1qzfa2
    complexed with cb3, dhf, ndp, ump; mutant

Details for d3dl5b2

PDB Entry: 3dl5 (more details), 2.74 Å

PDB Description: Crystal Structure of the A287F Active Site Mutant of TS-DHFR from Cryptosporidium hominis
PDB Compounds: (B:) Dihydrofolate reductase, DHFR

SCOPe Domain Sequences for d3dl5b2:

Sequence, based on SEQRES records: (download)

>d3dl5b2 d.117.1.1 (B:181-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvfirsifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

Sequence, based on observed residues (ATOM records): (download)

>d3dl5b2 d.117.1.1 (B:181-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
klksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvleng
ayrenrtgistysifgqmmrfdmresfpllttkkvfirsifeeliwfikgdtngnhliek
kvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakl
ietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgs
pfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkr
kveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d3dl5b2:

Click to download the PDB-style file with coordinates for d3dl5b2.
(The format of our PDB-style files is described here.)

Timeline for d3dl5b2: