Lineage for d3dl5d2 (3dl5 D:193-521)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579112Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)
  8. 2579115Domain d3dl5d2: 3dl5 D:193-521 [232026]
    Other proteins in same PDB: d3dl5a1, d3dl5b1, d3dl5c1, d3dl5d1, d3dl5e1
    automated match to d1qzfa2
    complexed with cb3, dhf, ndp, ump; mutant

Details for d3dl5d2

PDB Entry: 3dl5 (more details), 2.74 Å

PDB Description: crystal structure of the a287f active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (D:) Dihydrofolate reductase, DHFR

SCOPe Domain Sequences for d3dl5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl5d2 d.117.1.1 (D:193-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvfirsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d3dl5d2:

Click to download the PDB-style file with coordinates for d3dl5d2.
(The format of our PDB-style files is described here.)

Timeline for d3dl5d2: