Lineage for d1qppa2 (1qpp A:125-214)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792269Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 792270Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 792311Protein PapD [49586] (1 species)
  7. 792312Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 792319Domain d1qppa2: 1qpp A:125-214 [23202]
    Other proteins in same PDB: d1qppa1, d1qppb1

Details for d1qppa2

PDB Entry: 1qpp (more details), 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers
PDB Compounds: (A:) papd chaperone

SCOP Domain Sequences for d1qppa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qppa2 b.7.2.1 (A:125-214) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsv

SCOP Domain Coordinates for d1qppa2:

Click to download the PDB-style file with coordinates for d1qppa2.
(The format of our PDB-style files is described here.)

Timeline for d1qppa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qppa1