Lineage for d1qppa2 (1qpp A:125-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661406Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 661515Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 661516Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins)
  6. 661556Protein PapD [49586] (1 species)
  7. 661557Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 661563Domain d1qppa2: 1qpp A:125-214 [23202]
    Other proteins in same PDB: d1qppa1, d1qppb1

Details for d1qppa2

PDB Entry: 1qpp (more details), 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers
PDB Compounds: (A:) papd chaperone

SCOP Domain Sequences for d1qppa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qppa2 b.7.2.1 (A:125-214) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsv

SCOP Domain Coordinates for d1qppa2:

Click to download the PDB-style file with coordinates for d1qppa2.
(The format of our PDB-style files is described here.)

Timeline for d1qppa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qppa1