SCOP 1.73: Domain d1qppa2: 1qpp A:125-214

Lineage for d1qppa2 (1qpp A:125-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins)

6. Protein PapD [49586] (1 species)

7. Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)

8. Domain d1qppa2: 1qpp A:125-214 [23202]
   Other proteins in same PDB: d1qppa1, d1qppb1

Details for d1qppa2

PDB Entry: 1qpp, 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers

PDB Compounds: (A:) papd chaperone

SCOP Domain Sequences for d1qppa2:

Sequence; same for both SEQRES and ATOM records:

>d1qppa2 b.7.2.1 (A:125-214) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsv

Timeline for d1qppa2:

• d1qppa2 first appeared (with stable ids) in SCOP 1.55
  
• d1qppa2 appears in SCOP 1.71
  
• d1qppa2 appears in SCOP 1.75
  
• d1qppa2 appears in the current release, SCOPe 2.08