SCOPe 2.08: Domain d3dlub1: 3dlu B:2-100

Lineage for d3dlub1 (3dlu B:2-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.0: automated matches [232005] (1 protein)
   not a true family

6. Protein automated matches [232006] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [232008] (2 PDB entries)

8. Domain d3dlub1: 3dlu B:2-100 [232015]
   Other proteins in same PDB: d3dlua2, d3dlub2
   automated match to d1lnga_
   complexed with br, mli

Details for d3dlub1

PDB Entry: 3dlu, 1.8 Å

PDB Description: structures of srp54 and srp19, the two proteins assembling the ribonucleic core of the signal recognition particle from the archaeon pyrococcus furiosus.

PDB Compounds: (B:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d3dlub1:

Sequence, based on SEQRES records:

>d3dlub1 d.201.1.0 (B:2-100) automated matches {Pyrococcus furiosus [TaxId: 2261]}
grfvvwpseldsrlsrkygrivprsiavesprveeivraaeelkfkvirveedklnprls
gideelrtfgmivlespygkskslkliaqkirefrrrsa

Sequence, based on observed residues (ATOM records):

>d3dlub1 d.201.1.0 (B:2-100) automated matches {Pyrococcus furiosus [TaxId: 2261]}
grfvvwpseldsrlsrkygrivprsiavesprveeivraaeelkfkvirveedklnprtf
gmivlespygkskslkliaqkirefrrrsa

Timeline for d3dlub1:

• d3dlub1 first appeared in SCOPe 2.03, called d3dlub_
  
• d3dlub1 appears in SCOPe 2.07