![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (16 species) not a true protein |
![]() | Domain d3dl5d1: 3dl5 D:3-180 [232001] Other proteins in same PDB: d3dl5b2, d3dl5c2, d3dl5d2 automated match to d2oipa1 complexed with cb3, dhf, ndp, ump; mutant |
PDB Entry: 3dl5 (more details), 2.74 Å
SCOPe Domain Sequences for d3dl5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dl5d1 c.71.1.0 (D:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
Timeline for d3dl5d1: