Lineage for d1qpxa2 (1qpx A:125-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11348Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 11349Family b.7.2.1: Periplasmic chaperone C-domain [49585] (2 proteins)
  6. 11361Protein PapD [49586] (1 species)
  7. 11362Species Escherichia coli [TaxId:562] [49587] (4 PDB entries)
  8. 11363Domain d1qpxa2: 1qpx A:125-215 [23200]
    Other proteins in same PDB: d1qpxa1, d1qpxb1

Details for d1qpxa2

PDB Entry: 1qpx (more details), 2.4 Å

PDB Description: crystal structures of self-capping papd chaperone homodimers

SCOP Domain Sequences for d1qpxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpxa2 b.7.2.1 (A:125-215) PapD {Escherichia coli}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk

SCOP Domain Coordinates for d1qpxa2:

Click to download the PDB-style file with coordinates for d1qpxa2.
(The format of our PDB-style files is described here.)

Timeline for d1qpxa2:

11363
d1qpxa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qpxa1