Lineage for d3rpba_ (3rpb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. Protein C2b-domain of rabphilin [49582] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49583] (1 PDB entry)
  8. 2382686Domain d3rpba_: 3rpb A: [23199]

Details for d3rpba_

PDB Entry: 3rpb (more details)

PDB Description: the c2b-domain of rabphilin: structural variations in a janus-faced domain
PDB Compounds: (A:) rabphilin 3-a

SCOPe Domain Sequences for d3rpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rpba_ b.7.1.2 (A:) C2b-domain of rabphilin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rgkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqikk
ktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwye
clknkdkkierwhqlqnenh

SCOPe Domain Coordinates for d3rpba_:

Click to download the PDB-style file with coordinates for d3rpba_.
(The format of our PDB-style files is described here.)

Timeline for d3rpba_: