Lineage for d3daxb1 (3dax B:25-502)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005603Domain d3daxb1: 3dax B:25-502 [231987]
    Other proteins in same PDB: d3daxa2, d3daxa3, d3daxb2
    automated match to d3b98a_
    complexed with hem, unx

Details for d3daxb1

PDB Entry: 3dax (more details), 2.15 Å

PDB Description: crystal structure of human cyp7a1
PDB Compounds: (B:) Cytochrome P450 7A1

SCOPe Domain Sequences for d3daxb1:

Sequence, based on SEQRES records: (download)

>d3daxb1 a.104.1.0 (B:25-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahiln
nldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmfln
dtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagq
kvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkd
diialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgatic
pgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfk

Sequence, based on observed residues (ATOM records): (download)

>d3daxb1 a.104.1.0 (B:25-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimraawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnfkqfd
kvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlstfddl
ekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslegnpi
clsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypql
mhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaihe
ikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfk

SCOPe Domain Coordinates for d3daxb1:

Click to download the PDB-style file with coordinates for d3daxb1.
(The format of our PDB-style files is described here.)

Timeline for d3daxb1: