SCOPe 2.03: Domain d3dafa2: 3daf A:243-344

Lineage for d3dafa2 (3daf A:243-344)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein)
   dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains
   automatically mapped to Pfam PF03201

6. Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (4 PDB entries)
   Uniprot Q58194 243-344

8. Domain d3dafa2: 3daf A:243-344 [231983]
   Other proteins in same PDB: d3dafa1
   automated match to d2b0ja1
   complexed with cmo, cyn, fe2, feg, po4

Details for d3dafa2

PDB Entry: 3daf, 1.75 Å

PDB Description: the crystal structure of [fe]-hydrogenase holoenzyme (hmd) from methanocaldococcus jannaschii cocrystallized with cyanide

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3dafa2:

Sequence; same for both SEQRES and ATOM records:

>d3dafa2 a.100.1.11 (A:243-344) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi
anmeealdpaallgtadsmcfgplaeilptalkvlevhkvve

Timeline for d3dafa2:

• d3dafa2 is new in SCOPe 2.03-stable
  
• d3dafa2 appears in SCOPe 2.04
  
• d3dafa2 appears in the current release, SCOPe 2.08