SCOPe 2.05: Domain d1a25b_: 1a25 B:

Lineage for d1a25b_ (1a25 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein C2 domain from protein kinase c (beta) [49580] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49581] (1 PDB entry)

8. Domain d1a25b_: 1a25 B: [23198]
   complexed with ca, pse

Details for d1a25b_

PDB Entry: 1a25, 2.7 Å

PDB Description: c2 domain from protein kinase c (beta)

PDB Compounds: (B:) protein kinase c (beta)

SCOPe Domain Sequences for d1a25b_:

Sequence; same for both SEQRES and ATOM records:

>d1a25b_ b.7.1.2 (B:) C2 domain from protein kinase c (beta) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
errgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklklipdpkseskqktktik
cslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgslsfgiselqkagvdgwfk
llsqeegeyfnv

Timeline for d1a25b_:

• d1a25b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a25b_ appears in SCOPe 2.04
  
• d1a25b_ appears in SCOPe 2.06
  
• d1a25b_ appears in the current release, SCOPe 2.08