![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein C2 domain from protein kinase c (beta) [49580] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [49581] (1 PDB entry) |
![]() | Domain d1a25b_: 1a25 B: [23198] complexed with ca, pse |
PDB Entry: 1a25 (more details), 2.7 Å
SCOP Domain Sequences for d1a25b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a25b_ b.7.1.2 (B:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus)} errgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklklipdpkseskqktktik cslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgslsfgiselqkagvdgwfk llsqeegeyfnv
Timeline for d1a25b_: