Lineage for d1a25b_ (1a25 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies) Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins) 
Protein C2 domain from protein kinase c (beta) [49580] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49581] (1 PDB entry) 
Domain d1a25b_: 1a25 B: [23198]
Details for d1a25b_
PDB Entry: 1a25 (more details), 2.7 Å
PDB Description: c2 domain from protein kinase c (beta)
SCOP Domain Sequences for d1a25b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a25b_ b.7.1.2 (B:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus)}
errgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklklipdpkseskqktktik
cslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgslsfgiselqkagvdgwfk
llsqeegeyfnv
SCOP Domain Coordinates for d1a25b_:
Click to download the PDB-style file with coordinates for d1a25b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a25b_:
- d1a25b_ appears in SCOP 1.57
- d1a25b_ appears in the current release, SCOPe 2.08
View in 3D
