Lineage for d1dsya_ (1dsy A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 56369Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 56370Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 56418Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins)
  6. 56419Protein C2 domain from protein kinase c (alpha) [49578] (1 species)
  7. 56420Species Rat (Rattus norvegicus) [TaxId:10116] [49579] (1 PDB entry)
  8. 56421Domain d1dsya_: 1dsy A: [23196]

Details for d1dsya_

PDB Entry: 1dsy (more details), 2.6 Å

PDB Description: c2 domain from protein kinase c (alpha) complexed with ca2+ and phosphatidylserine

SCOP Domain Sequences for d1dsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsya_ b.7.1.2 (A:) C2 domain from protein kinase c (alpha) {Rat (Rattus norvegicus)}
tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
kllnqeegeyynvpipe

SCOP Domain Coordinates for d1dsya_:

Click to download the PDB-style file with coordinates for d1dsya_.
(The format of our PDB-style files is described here.)

Timeline for d1dsya_: