Lineage for d3d9fd1 (3d9f D:2-260)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570414Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2570504Protein automated matches [226961] (2 species)
    not a true protein
  7. 2570505Species Fungus (Fusarium oxysporum) [TaxId:5507] [231929] (7 PDB entries)
  8. 2570525Domain d3d9fd1: 3d9f D:2-260 [231955]
    Other proteins in same PDB: d3d9fa2, d3d9fb2, d3d9fc2, d3d9fd2
    automated match to d2c0ua2
    complexed with fad, gol, n6c; mutant

Details for d3d9fd1

PDB Entry: 3d9f (more details), 2.2 Å

PDB Description: nitroalkane oxidase: active site mutant s276a crystallized with 1- nitrohexane
PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d3d9fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9fd1 e.6.1.1 (D:2-260) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOPe Domain Coordinates for d3d9fd1:

Click to download the PDB-style file with coordinates for d3d9fd1.
(The format of our PDB-style files is described here.)

Timeline for d3d9fd1: