![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptotagmin III [109606] (1 species) duplication: contains 2 C2 domains |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [109607] (1 PDB entry) Uniprot P40748 293-588 |
![]() | Domain d1dqva2: 1dqv A:425-569 [23195] complexed with mg, so4 |
PDB Entry: 1dqv (more details), 3.2 Å
SCOPe Domain Sequences for d1dqva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Norway rat (Rattus norvegicus) [TaxId: 10116]} sekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkaslisegrrlkkrk tsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigvcrvgpeaadphg rehwaemlanprkpvehwhqlveek
Timeline for d1dqva2: