Lineage for d1dqva2 (1dqv A:425-569)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661406Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 661407Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 661469Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 661502Protein Synaptotagmin III [109606] (1 species)
    duplication: contains 2 C2 domains
  7. 661503Species Rat (Rattus norvegicus) [TaxId:10116] [109607] (1 PDB entry)
  8. 661505Domain d1dqva2: 1dqv A:425-569 [23195]

Details for d1dqva2

PDB Entry: 1dqv (more details), 3.2 Å

PDB Description: crystal structure of synaptotagmin iii c2a/c2b
PDB Compounds: (A:) synaptotagmin III

SCOP Domain Sequences for d1dqva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}
sekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkaslisegrrlkkrk
tsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigvcrvgpeaadphg
rehwaemlanprkpvehwhqlveek

SCOP Domain Coordinates for d1dqva2:

Click to download the PDB-style file with coordinates for d1dqva2.
(The format of our PDB-style files is described here.)

Timeline for d1dqva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqva1