SCOP 1.69: Domain d1dqva2: 1dqv A:425-569

Lineage for d1dqva2 (1dqv A:425-569)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (8 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptotagmin III [109606] (1 species)
   duplication: contains 2 C2 domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [109607] (1 PDB entry)

8. Domain d1dqva2: 1dqv A:425-569 [23195]

Details for d1dqva2

PDB Entry: 1dqv, 3.2 Å

PDB Description: crystal structure of synaptotagmin iii c2a/c2b

SCOP Domain Sequences for d1dqva2:

Sequence; same for both SEQRES and ATOM records:

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) }
sekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkaslisegrrlkkrk
tsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigvcrvgpeaadphg
rehwaemlanprkpvehwhqlveek

Timeline for d1dqva2:

• d1dqva2 first appeared (with stable ids) in SCOP 1.55
  
• d1dqva2 appears in SCOP 1.67
  
• d1dqva2 appears in SCOP 1.71
  
• d1dqva2 appears in the current release, SCOPe 2.08