SCOPe 2.04: Domain d1dqva1: 1dqv A:295-424

Lineage for d1dqva1 (1dqv A:295-424)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptotagmin III [109606] (1 species)
   duplication: contains 2 C2 domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [109607] (1 PDB entry)
   Uniprot P40748 293-588

8. Domain d1dqva1: 1dqv A:295-424 [23194]
   complexed with mg, so4

Details for d1dqva1

PDB Entry: 1dqv, 3.2 Å

PDB Description: crystal structure of synaptotagmin iii c2a/c2b

PDB Compounds: (A:) synaptotagmin III

SCOPe Domain Sequences for d1dqva1:

Sequence; same for both SEQRES and ATOM records:

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
plwrdilegg

Timeline for d1dqva1:

• d1dqva1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqva1 appears in SCOPe 2.03
  
• d1dqva1 appears in SCOPe 2.05
  
• d1dqva1 appears in the current release, SCOPe 2.08