Lineage for d1dqva1 (1dqv A:295-424)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11283Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 11331Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 protein domains)
  6. 11342Protein Synaptogamin I [49576] (1 species)
  7. 11343Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (3 PDB entries)
  8. 11346Domain d1dqva1: 1dqv A:295-424 [23194]

Details for d1dqva1

PDB Entry: 1dqv (more details), 3.2 Å

PDB Description: crystal structure of synaptotagmin iii c2a/c2b

SCOP Domain Sequences for d1dqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqva1 b.7.1.2 (A:295-424) Synaptogamin I {Rat (Rattus norvegicus)}
gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
plwrdilegg

SCOP Domain Coordinates for d1dqva1:

Click to download the PDB-style file with coordinates for d1dqva1.
(The format of our PDB-style files is described here.)

Timeline for d1dqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqva2