Lineage for d1dqva1 (1dqv A:295-424)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies) Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins) Protein Synaptogamin I [49576] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (3 PDB entries) 
Domain d1dqva1: 1dqv A:295-424 [23194]
Details for d1dqva1
PDB Entry: 1dqv (more details), 3.2 Å
PDB Description: crystal structure of synaptotagmin iii c2a/c2b
SCOP Domain Sequences for d1dqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqva1 b.7.1.2 (A:295-424) Synaptogamin I {Rat (Rattus norvegicus)}
gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
plwrdilegg
SCOP Domain Coordinates for d1dqva1:
Click to download the PDB-style file with coordinates for d1dqva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dqva1:
- d1dqva1 appears in SCOP 1.57
- d1dqva1 appears in the current release, SCOPe 2.08
View in 3D
