Lineage for d1dqva1 (1dqv A:295-424)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. Protein Synaptotagmin III [109606] (1 species)
    duplication: contains 2 C2 domains
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [109607] (1 PDB entry)
    Uniprot P40748 293-588
  8. Domain d1dqva1: 1dqv A:295-424 [23194]
    complexed with mg, so4

Details for d1dqva1

PDB Entry: 1dqv (more details), 3.2 Å

PDB Description: crystal structure of synaptotagmin iii c2a/c2b
PDB Compounds: (A:) synaptotagmin III

SCOPe Domain Sequences for d1dqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
plwrdilegg

SCOPe Domain Coordinates for d1dqva1 are not available.

Timeline for d1dqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqva2