Lineage for d3d9dc2 (3d9d C:261-431)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321546Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2321636Protein automated matches [231931] (2 species)
    not a true protein
  7. 2321637Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries)
  8. 2321640Domain d3d9dc2: 3d9d C:261-431 [231937]
    Other proteins in same PDB: d3d9da1, d3d9db1, d3d9dc1, d3d9dd1
    automated match to d2c0ua1
    complexed with fad, gol, n6c; mutant

Details for d3d9dc2

PDB Entry: 3d9d (more details), 2.1 Å

PDB Description: nitroalkane oxidase: mutant d402n crystallized with 1-nitrohexane
PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d3d9dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9dc2 a.29.3.1 (C:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfnggniglrrrqmqrvmaledyepwaatygs

SCOPe Domain Coordinates for d3d9dc2:

Click to download the PDB-style file with coordinates for d3d9dc2.
(The format of our PDB-style files is described here.)

Timeline for d3d9dc2: