![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
![]() | Protein automated matches [231931] (2 species) not a true protein |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries) |
![]() | Domain d3d9db2: 3d9d B:261-432 [231935] Other proteins in same PDB: d3d9da1, d3d9db1, d3d9dc1, d3d9dd1 automated match to d2c0ua1 complexed with fad, gol, n6c; mutant |
PDB Entry: 3d9d (more details), 2.1 Å
SCOPe Domain Sequences for d3d9db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9db2 a.29.3.1 (B:261-432) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfnggniglrrrqmqrvmaledyepwaatygss
Timeline for d3d9db2: