Lineage for d1byna_ (1byn A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458377Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 458378Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 458429Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (8 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 458446Protein Synaptogamin I [49576] (1 species)
    duplication: contains tandem repeat of two similar domains
  7. 458447Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (6 PDB entries)
  8. 458452Domain d1byna_: 1byn A: [23193]
    first C2 domain

Details for d1byna_

PDB Entry: 1byn (more details)

PDB Description: solution structure of the calcium-bound first c2-domain of synaptotagmin i

SCOP Domain Sequences for d1byna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byna_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus)}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

SCOP Domain Coordinates for d1byna_:

Click to download the PDB-style file with coordinates for d1byna_.
(The format of our PDB-style files is described here.)

Timeline for d1byna_: