Lineage for d3d7ta_ (3d7t A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929618Protein Carboxyl-terminal src kinase (csk) [56164] (1 species)
    PTK group; CSK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1929619Species Human (Homo sapiens) [TaxId:9606] [56165] (4 PDB entries)
  8. 1929627Domain d3d7ta_: 3d7t A: [231928]
    Other proteins in same PDB: d3d7tb_
    automated match to d3js2a_
    complexed with stu

Details for d3d7ta_

PDB Entry: 3d7t (more details), 2.9 Å

PDB Description: Structural basis for the recognition of c-Src by its inactivator Csk
PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d3d7ta_:

Sequence, based on SEQRES records: (download)

>d3d7ta_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
nnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealreaafstks
dvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhlda
amrpsflqlreqlehikthelhl

Sequence, based on observed residues (ATOM records): (download)

>d3d7ta_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
nnfvhrdlaarnvlvsednvakvsdfgpvkwtapealreaafstksdvwsfgillweiys
fgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsflqlreqle
hikthelhl

SCOPe Domain Coordinates for d3d7ta_:

Click to download the PDB-style file with coordinates for d3d7ta_.
(The format of our PDB-style files is described here.)

Timeline for d3d7ta_: