| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Aquifex aeolicus [TaxId:63363] [229765] (2 PDB entries) |
| Domain d3d6nb2: 3d6n B:143-291 [231927] automated match to d4bjhb2 protein/RNA complex; complexed with flc, zn |
PDB Entry: 3d6n (more details), 2.3 Å
SCOPe Domain Sequences for d3d6nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d6nb2 c.78.1.0 (B:143-291) automated matches {Aquifex aeolicus [TaxId: 63363]}
evkdlrvlyvgdikhsrvfrsgapllnmfgakigvcgpktliprdvevfkvdvfddvdkg
idwadvviwlrlqkerqkenyipsessyfkqfgltkerfekvklymhpgpvnrnvdidhe
lvyteksliqeqvkngipvrkaiykflwt
Timeline for d3d6nb2: