Lineage for d3d6nb2 (3d6n B:143-291)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906886Species Aquifex aeolicus [TaxId:63363] [229765] (2 PDB entries)
  8. 2906888Domain d3d6nb2: 3d6n B:143-291 [231927]
    automated match to d4bjhb2
    protein/RNA complex; complexed with flc, zn

Details for d3d6nb2

PDB Entry: 3d6n (more details), 2.3 Å

PDB Description: Crystal Structure of Aquifex Dihydroorotase Activated by Aspartate Transcarbamoylase
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3d6nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d6nb2 c.78.1.0 (B:143-291) automated matches {Aquifex aeolicus [TaxId: 63363]}
evkdlrvlyvgdikhsrvfrsgapllnmfgakigvcgpktliprdvevfkvdvfddvdkg
idwadvviwlrlqkerqkenyipsessyfkqfgltkerfekvklymhpgpvnrnvdidhe
lvyteksliqeqvkngipvrkaiykflwt

SCOPe Domain Coordinates for d3d6nb2:

Click to download the PDB-style file with coordinates for d3d6nb2.
(The format of our PDB-style files is described here.)

Timeline for d3d6nb2: