SCOPe 2.03: Domain d3d6nb1: 3d6n B:1-142

Lineage for d3d6nb1 (3d6n B:1-142)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (20 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [229765] (2 PDB entries)

8. Domain d3d6nb1: 3d6n B:1-142 [231926]
   automated match to d4bjhb1
   protein/RNA complex; complexed with flc, zn

Details for d3d6nb1

PDB Entry: 3d6n, 2.3 Å

PDB Description: Crystal Structure of Aquifex Dihydroorotase Activated by Aspartate Transcarbamoylase

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3d6nb1:

Sequence; same for both SEQRES and ATOM records:

>d3d6nb1 c.78.1.0 (B:1-142) automated matches {Aquifex aeolicus [TaxId: 63363]}
mrslissldltreeveeilkyakefkegkeetikasavlffsepstrtrlsfekaarelg
ietylvsgsesstvkgesffdtlktfeglgfdyvvfrvpfvffpykeivkslnlrlvnag
dgthqhpsqglidfftikehfg

Timeline for d3d6nb1:

• d3d6nb1 is new in SCOPe 2.03-stable
  
• d3d6nb1 appears in SCOPe 2.04
  
• d3d6nb1 appears in the current release, SCOPe 2.08