SCOPe 2.04: Domain d3czma2: 3czm A:164-331

Lineage for d3czma2 (3czm A:164-331)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (19 species)

7. Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)

8. Domain d3czma2: 3czm A:164-331 [231923]
   Other proteins in same PDB: d3czma1, d3czmb1
   automated match to d1pzgc2
   complexed with nad, oxq

Details for d3czma2

PDB Entry: 3czm, 2.3 Å

PDB Description: t. gondii bradyzoite-specific ldh (ldh2) in complex with nad and oxq

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3czma2:

Sequence; same for both SEQRES and ATOM records:

>d3czma2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt
eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey
glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal

Timeline for d3czma2:

• d3czma2 first appeared in SCOPe 2.03
  
• d3czma2 appears in SCOPe 2.05
  
• d3czma2 appears in the current release, SCOPe 2.08