Lineage for d3czma2 (3czm A:164-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2557053Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 2557067Domain d3czma2: 3czm A:164-331 [231923]
    Other proteins in same PDB: d3czma1, d3czmb1
    automated match to d1pzgc2
    complexed with nad, oxq

Details for d3czma2

PDB Entry: 3czm (more details), 2.3 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH2) in complex with NAD and OXQ
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3czma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czma2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt
eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey
glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal

SCOPe Domain Coordinates for d3czma2:

Click to download the PDB-style file with coordinates for d3czma2.
(The format of our PDB-style files is described here.)

Timeline for d3czma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3czma1