![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries) |
![]() | Domain d3d0sb2: 3d0s B:145-215 [231922] Other proteins in same PDB: d3d0sa1, d3d0sb1, d3d0sb3 automated match to d3r6sd2 complexed with cl |
PDB Entry: 3d0s (more details), 2 Å
SCOPe Domain Sequences for d3d0sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0sb2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi rlegksvlisd
Timeline for d3d0sb2: