Lineage for d3d0sb2 (3d0s B:145-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694919Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)
  8. 2694921Domain d3d0sb2: 3d0s B:145-215 [231922]
    Other proteins in same PDB: d3d0sa1, d3d0sb1, d3d0sb3
    automated match to d3r6sd2
    complexed with cl

Details for d3d0sb2

PDB Entry: 3d0s (more details), 2 Å

PDB Description: camp receptor protein from m.tuberculosis, camp-free form
PDB Compounds: (B:) transcriptional regulatory protein

SCOPe Domain Sequences for d3d0sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0sb2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisd

SCOPe Domain Coordinates for d3d0sb2:

Click to download the PDB-style file with coordinates for d3d0sb2.
(The format of our PDB-style files is described here.)

Timeline for d3d0sb2: