SCOPe 2.05: Domain d3d0sa1: 3d0s A:1-144

Lineage for d3d0sa1 (3d0s A:1-144)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)

8. Domain d3d0sa1: 3d0s A:1-144 [231920]
   Other proteins in same PDB: d3d0sa2, d3d0sb2
   automated match to d3r6sf1
   complexed with cl

Details for d3d0sa1

PDB Entry: 3d0s, 2 Å

PDB Description: camp receptor protein from m.tuberculosis, camp-free form

PDB Compounds: (A:) transcriptional regulatory protein

SCOPe Domain Sequences for d3d0sa1:

Sequence; same for both SEQRES and ATOM records:

>d3d0sa1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift

Timeline for d3d0sa1:

• d3d0sa1 first appeared in SCOPe 2.03
  
• d3d0sa1 appears in SCOPe 2.04
  
• d3d0sa1 appears in SCOPe 2.06
  
• d3d0sa1 appears in the current release, SCOPe 2.08