Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (11 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries) |
Domain d3d0sa1: 3d0s A:1-144 [231920] Other proteins in same PDB: d3d0sa2, d3d0sb2 automated match to d3r6sf1 complexed with cl |
PDB Entry: 3d0s (more details), 2 Å
SCOPe Domain Sequences for d3d0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0sa1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis eqllrvlarrlrrtnnnladlift
Timeline for d3d0sa1: