Lineage for d1rsy__ (1rsy -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554333Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 554334Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 554385Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 554405Protein Synaptogamin I [49576] (1 species)
    duplication: contains tandem repeat of two similar domains
  7. 554406Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
  8. 554411Domain d1rsy__: 1rsy - [23192]
    first C2 domain
    CASP1
    complexed with so4

Details for d1rsy__

PDB Entry: 1rsy (more details), 1.9 Å

PDB Description: structure of the first c2-domain of synaptotagmin i: a novel ca2+(slash)phospholipid binding fold

SCOP Domain Sequences for d1rsy__:

Sequence, based on SEQRES records: (download)

>d1rsy__ b.7.1.2 (-) Synaptogamin I {Rat (Rattus norvegicus)}
gggildsmvekeepkeeeklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
fkvpmntvdfghvteewrdlqsa

Sequence, based on observed residues (ATOM records): (download)

>d1rsy__ b.7.1.2 (-) Synaptogamin I {Rat (Rattus norvegicus)}
gggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkk
kkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntv
dfghvteewrdlqsa

SCOP Domain Coordinates for d1rsy__:

Click to download the PDB-style file with coordinates for d1rsy__.
(The format of our PDB-style files is described here.)

Timeline for d1rsy__: