Lineage for d1rsy__ (1rsy -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11283Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 11331Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins)
  6. 11342Protein Synaptogamin I [49576] (1 species)
  7. 11343Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (3 PDB entries)
  8. 11344Domain d1rsy__: 1rsy - [23192]

Details for d1rsy__

PDB Entry: 1rsy (more details), 1.9 Å

PDB Description: structure of the first c2-domain of synaptotagmin i: a novel ca2+(slash)phospholipid binding fold

SCOP Domain Sequences for d1rsy__:

Sequence, based on SEQRES records: (download)

>d1rsy__ b.7.1.2 (-) Synaptogamin I {Rat (Rattus norvegicus)}
gggildsmvekeepkeeeklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
fkvpmntvdfghvteewrdlqsa

Sequence, based on observed residues (ATOM records): (download)

>d1rsy__ b.7.1.2 (-) Synaptogamin I {Rat (Rattus norvegicus)}
gggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkk
kkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntv
dfghvteewrdlqsa

SCOP Domain Coordinates for d1rsy__:

Click to download the PDB-style file with coordinates for d1rsy__.
(The format of our PDB-style files is described here.)

Timeline for d1rsy__: